BMP10 purified MaxPab mouse polyclonal antibody (B02P)
  • BMP10 purified MaxPab mouse polyclonal antibody (B02P)

BMP10 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00027302-B02P
BMP10 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BMP10 protein.
Información adicional
Size 50 ug
Gene Name BMP10
Gene Alias MGC126783
Gene Description bone morphogenetic protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BMP10 (NP_055297.1, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27302

Enviar uma mensagem


BMP10 purified MaxPab mouse polyclonal antibody (B02P)

BMP10 purified MaxPab mouse polyclonal antibody (B02P)