C20orf10 monoclonal antibody (M01), clone 3C2
  • C20orf10 monoclonal antibody (M01), clone 3C2

C20orf10 monoclonal antibody (M01), clone 3C2

Ref: AB-H00027296-M01
C20orf10 monoclonal antibody (M01), clone 3C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C20orf10.
Información adicional
Size 100 ug
Gene Name TP53TG5
Gene Alias C20orf10|CLG01
Gene Description TP53 target 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RNRTPMGHMKQLDVADQWIWFEGLPTRIHLPAPRVMCRSSTLRWVKRRCTRFCSASLEMPMWHPYKVDVTWTRARGASRGWRSRHQLKGRNGWRNSRVYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf10 (AAH36785, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27296
Clone Number 3C2
Iso type IgG2a Kappa

Enviar uma mensagem


C20orf10 monoclonal antibody (M01), clone 3C2

C20orf10 monoclonal antibody (M01), clone 3C2