SMPDL3B monoclonal antibody (M01), clone 5E12
  • SMPDL3B monoclonal antibody (M01), clone 5E12

SMPDL3B monoclonal antibody (M01), clone 5E12

Ref: AB-H00027293-M01
SMPDL3B monoclonal antibody (M01), clone 5E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMPDL3B.
Información adicional
Size 100 ug
Gene Name SMPDL3B
Gene Alias ASML3B
Gene Description sphingomyelin phosphodiesterase, acid-like 3B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMPDL3B (NP_001009568, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27293
Clone Number 5E12
Iso type IgG3 Kappa

Enviar uma mensagem


SMPDL3B monoclonal antibody (M01), clone 5E12

SMPDL3B monoclonal antibody (M01), clone 5E12