RND1 polyclonal antibody (A01)
  • RND1 polyclonal antibody (A01)

RND1 polyclonal antibody (A01)

Ref: AB-H00027289-A01
RND1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RND1.
Información adicional
Size 50 uL
Gene Name RND1
Gene Alias ARHS|FLJ42294|RHO6|RHOS
Gene Description Rho family GTPase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RND1 (NP_055285, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27289

Enviar uma mensagem


RND1 polyclonal antibody (A01)

RND1 polyclonal antibody (A01)