VENTX purified MaxPab mouse polyclonal antibody (B01P)
  • VENTX purified MaxPab mouse polyclonal antibody (B01P)

VENTX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027287-B01P
VENTX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VENTX protein.
Información adicional
Size 50 ug
Gene Name VENTX
Gene Alias HPX42B|MGC119910|MGC119911|NA88A|VENTX2
Gene Description VENT homeobox homolog (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VENTX (NP_055283.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27287

Enviar uma mensagem


VENTX purified MaxPab mouse polyclonal antibody (B01P)

VENTX purified MaxPab mouse polyclonal antibody (B01P)