SULT1B1 monoclonal antibody (M04A), clone 4C9
  • SULT1B1 monoclonal antibody (M04A), clone 4C9

SULT1B1 monoclonal antibody (M04A), clone 4C9

Ref: AB-H00027284-M04A
SULT1B1 monoclonal antibody (M04A), clone 4C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SULT1B1.
Información adicional
Size 200 uL
Gene Name SULT1B1
Gene Alias MGC13356|ST1B2|SULT1B2
Gene Description sulfotransferase family, cytosolic, 1B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULT1B1 (NP_055280.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 27284
Clone Number 4C9
Iso type IgM Kappa

Enviar uma mensagem


SULT1B1 monoclonal antibody (M04A), clone 4C9

SULT1B1 monoclonal antibody (M04A), clone 4C9