LSM3 monoclonal antibody (M08), clone 4H3
  • LSM3 monoclonal antibody (M08), clone 4H3

LSM3 monoclonal antibody (M08), clone 4H3

Ref: AB-H00027258-M08
LSM3 monoclonal antibody (M08), clone 4H3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant LSM3.
Información adicional
Size 100 ug
Gene Name LSM3
Gene Alias SMX4|USS2|YLR438C
Gene Description LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LSM3 (AAH07055, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27258
Clone Number 4H3
Iso type IgG2a Kappa

Enviar uma mensagem


LSM3 monoclonal antibody (M08), clone 4H3

LSM3 monoclonal antibody (M08), clone 4H3