LSM1 purified MaxPab mouse polyclonal antibody (B01P)
  • LSM1 purified MaxPab mouse polyclonal antibody (B01P)

LSM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027257-B01P
LSM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LSM1 protein.
Información adicional
Size 50 ug
Gene Name LSM1
Gene Alias CASM|YJL124C
Gene Description LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LSM1 (NP_055277.1, 1 a.a. ~ 133 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27257

Enviar uma mensagem


LSM1 purified MaxPab mouse polyclonal antibody (B01P)

LSM1 purified MaxPab mouse polyclonal antibody (B01P)