PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)

PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027250-D01P
PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDCD4 protein.
Información adicional
Size 100 ug
Gene Name PDCD4
Gene Alias H731|MGC33046|MGC33047
Gene Description programmed cell death 4 (neoplastic transformation inhibitor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEVKNEINGNWISAYSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDCD4 (AAH26104.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27250

Enviar uma mensagem


PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)

PDCD4 purified MaxPab rabbit polyclonal antibody (D01P)