RNF115 purified MaxPab mouse polyclonal antibody (B01P)
  • RNF115 purified MaxPab mouse polyclonal antibody (B01P)

RNF115 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027246-B01P
RNF115 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNF115 protein.
Información adicional
Size 50 ug
Gene Name RNF115
Gene Alias BCA2|ZNF364
Gene Description ring finger protein 115
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF115 (NP_055270.1, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27246

Enviar uma mensagem


RNF115 purified MaxPab mouse polyclonal antibody (B01P)

RNF115 purified MaxPab mouse polyclonal antibody (B01P)