BBS9 purified MaxPab rabbit polyclonal antibody (D02P)
  • BBS9 purified MaxPab rabbit polyclonal antibody (D02P)

BBS9 purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00027241-D02P
BBS9 purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BBS9 protein.
Información adicional
Size 100 ug
Gene Name BBS9
Gene Alias B1|C18|D1|MGC118917|PTHB1
Gene Description Bardet-Biedl syndrome 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BBS9 (AAH32715.1, 1 a.a. ~ 310 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27241

Enviar uma mensagem


BBS9 purified MaxPab rabbit polyclonal antibody (D02P)

BBS9 purified MaxPab rabbit polyclonal antibody (D02P)