ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)
  • ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)

ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027237-B01P
ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARHGEF16 protein.
Información adicional
Size 50 ug
Gene Name ARHGEF16
Gene Alias GEF16|NBR
Gene Description Rho guanine exchange factor (GEF) 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGEF16 (AAH02681, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27237

Enviar uma mensagem


ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)

ARHGEF16 purified MaxPab mouse polyclonal antibody (B01P)