COQ2 monoclonal antibody (M03), clone 2B4
  • COQ2 monoclonal antibody (M03), clone 2B4

COQ2 monoclonal antibody (M03), clone 2B4

Ref: AB-H00027235-M03
COQ2 monoclonal antibody (M03), clone 2B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COQ2.
Información adicional
Size 100 ug
Gene Name COQ2
Gene Alias CL640|FLJ26072
Gene Description coenzyme Q2 homolog, prenyltransferase (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COQ2 (NP_056512.3, 84 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27235
Clone Number 2B4
Iso type IgG1 Kappa

Enviar uma mensagem


COQ2 monoclonal antibody (M03), clone 2B4

COQ2 monoclonal antibody (M03), clone 2B4