SULT1C2 monoclonal antibody (M01), clone 4D9
  • SULT1C2 monoclonal antibody (M01), clone 4D9

SULT1C2 monoclonal antibody (M01), clone 4D9

Ref: AB-H00027233-M01
SULT1C2 monoclonal antibody (M01), clone 4D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SULT1C2.
Información adicional
Size 100 ug
Gene Name SULT1C4
Gene Alias MGC149521|MGC34422|SULT1C|SULT1C2
Gene Description sulfotransferase family, cytosolic, 1C, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULT1C2 (AAH58861.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27233
Clone Number 4D9
Iso type IgG2b Kappa

Enviar uma mensagem


SULT1C2 monoclonal antibody (M01), clone 4D9

SULT1C2 monoclonal antibody (M01), clone 4D9