IL17B purified MaxPab rabbit polyclonal antibody (D01P)
  • IL17B purified MaxPab rabbit polyclonal antibody (D01P)

IL17B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027190-D01P
IL17B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL17B protein.
Información adicional
Size 100 ug
Gene Name IL17B
Gene Alias IL-17B|IL-20|MGC138900|MGC138901|ZCYTO7
Gene Description interleukin 17B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL17B (NP_055258.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27190

Enviar uma mensagem


IL17B purified MaxPab rabbit polyclonal antibody (D01P)

IL17B purified MaxPab rabbit polyclonal antibody (D01P)