IL17C purified MaxPab rabbit polyclonal antibody (D01P)
  • IL17C purified MaxPab rabbit polyclonal antibody (D01P)

IL17C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027189-D01P
IL17C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL17C protein.
Información adicional
Size 100 ug
Gene Name IL17C
Gene Alias CX2|IL-17C|IL-21|MGC126884|MGC138401
Gene Description interleukin 17C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL17C (NP_037410.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27189

Enviar uma mensagem


IL17C purified MaxPab rabbit polyclonal antibody (D01P)

IL17C purified MaxPab rabbit polyclonal antibody (D01P)