SIGLEC8 monoclonal antibody (M03), clone 3H1 View larger

Mouse monoclonal antibody raised against a partial recombinant SIGLEC8.

AB-H00027181-M03

New product

SIGLEC8 monoclonal antibody (M03), clone 3H1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SIGLEC8
Gene Alias MGC59785|SAF2|SIGLEC-8|SIGLEC8L
Gene Description sialic acid binding Ig-like lectin 8
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIGLEC8 (NP_055257, 18 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27181
Clone Number 3H1
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SIGLEC8.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SIGLEC8.

Mouse monoclonal antibody raised against a partial recombinant SIGLEC8.