SIGLEC8 monoclonal antibody (M03), clone 3H1
  • SIGLEC8 monoclonal antibody (M03), clone 3H1

SIGLEC8 monoclonal antibody (M03), clone 3H1

Ref: AB-H00027181-M03
SIGLEC8 monoclonal antibody (M03), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIGLEC8.
Información adicional
Size 100 ug
Gene Name SIGLEC8
Gene Alias MGC59785|SAF2|SIGLEC-8|SIGLEC8L
Gene Description sialic acid binding Ig-like lectin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIGLEC8 (NP_055257, 18 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27181
Clone Number 3H1
Iso type IgG2b Kappa

Enviar uma mensagem


SIGLEC8 monoclonal antibody (M03), clone 3H1

SIGLEC8 monoclonal antibody (M03), clone 3H1