NAAA monoclonal antibody (M01), clone 5E3
  • NAAA monoclonal antibody (M01), clone 5E3

NAAA monoclonal antibody (M01), clone 5E3

Ref: AB-H00027163-M01
NAAA monoclonal antibody (M01), clone 5E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NAAA.
Información adicional
Size 100 ug
Gene Name NAAA
Gene Alias ASAHL|PLT
Gene Description N-acylethanolamine acid amidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAAA (NP_055250, 36 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27163
Clone Number 5E3
Iso type IgG2a Kappa

Enviar uma mensagem


NAAA monoclonal antibody (M01), clone 5E3

NAAA monoclonal antibody (M01), clone 5E3