EIF2C2 monoclonal antibody (M05), clone 2H2
  • EIF2C2 monoclonal antibody (M05), clone 2H2

EIF2C2 monoclonal antibody (M05), clone 2H2

Ref: AB-H00027161-M05
EIF2C2 monoclonal antibody (M05), clone 2H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF2C2.
Información adicional
Size 100 ug
Gene Name EIF2C2
Gene Alias AGO2|MGC3183|Q10
Gene Description eukaryotic translation initiation factor 2C, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF2C2 (NP_036286.2, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27161
Clone Number 2H2
Iso type IgG2a Kappa

Enviar uma mensagem


EIF2C2 monoclonal antibody (M05), clone 2H2

EIF2C2 monoclonal antibody (M05), clone 2H2