NDOR1 monoclonal antibody (M01A), clone 3A11
  • NDOR1 monoclonal antibody (M01A), clone 3A11

NDOR1 monoclonal antibody (M01A), clone 3A11

Ref: AB-H00027158-M01A
NDOR1 monoclonal antibody (M01A), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDOR1.
Información adicional
Size 200 uL
Gene Name NDOR1
Gene Alias MGC138148|NR1|bA350O14.9
Gene Description NADPH dependent diflavin oxidoreductase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 27158
Clone Number 3A11
Iso type IgG2a Kappa

Enviar uma mensagem


NDOR1 monoclonal antibody (M01A), clone 3A11

NDOR1 monoclonal antibody (M01A), clone 3A11