CIDEB polyclonal antibody (A01)
  • CIDEB polyclonal antibody (A01)

CIDEB polyclonal antibody (A01)

Ref: AB-H00027141-A01
CIDEB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CIDEB.
Información adicional
Size 50 uL
Gene Name CIDEB
Gene Alias -
Gene Description cell death-inducing DFFA-like effector b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIDEB (NP_055245, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27141

Enviar uma mensagem


CIDEB polyclonal antibody (A01)

CIDEB polyclonal antibody (A01)