Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AFF4 polyclonal antibody (A01)
Abnova
AFF4 polyclonal antibody (A01)
Ref: AB-H00027125-A01
AFF4 polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant AFF4.
Información adicional
Size
50 uL
Gene Name
AFF4
Gene Alias
AF5Q31|MCEF|MGC75036
Gene Description
AF4/FMR2 family, member 4
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
27125
Enviar uma mensagem
AFF4 polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*