TAF5L monoclonal antibody (M01), clone 1C5
  • TAF5L monoclonal antibody (M01), clone 1C5

TAF5L monoclonal antibody (M01), clone 1C5

Ref: AB-H00027097-M01
TAF5L monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TAF5L.
Información adicional
Size 50 ug
Gene Name TAF5L
Gene Alias PAF65B
Gene Description TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAF5L (NP_055224, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27097
Clone Number 1C5
Iso type IgG2b Kappa

Enviar uma mensagem


TAF5L monoclonal antibody (M01), clone 1C5

TAF5L monoclonal antibody (M01), clone 1C5