B3GAT1 polyclonal antibody (A01)
  • B3GAT1 polyclonal antibody (A01)

B3GAT1 polyclonal antibody (A01)

Ref: AB-H00027087-A01
B3GAT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant B3GAT1.
Información adicional
Size 50 uL
Gene Name B3GAT1
Gene Alias CD57|GLCATP|GlcAT-P|GlcUAT-P|HNK-1|HNK1|LEU7|NK-1
Gene Description beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B3GAT1 (NP_061114, 235 a.a. ~ 332 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27087

Enviar uma mensagem


B3GAT1 polyclonal antibody (A01)

B3GAT1 polyclonal antibody (A01)