FOXP1 monoclonal antibody (M01), clone 4E3-G11
  • FOXP1 monoclonal antibody (M01), clone 4E3-G11

FOXP1 monoclonal antibody (M01), clone 4E3-G11

Ref: AB-H00027086-M01
FOXP1 monoclonal antibody (M01), clone 4E3-G11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FOXP1.
Información adicional
Size 100 ug
Gene Name FOXP1
Gene Alias 12CC4|FLJ23741|HSPC215|MGC12942|MGC88572|MGC99551|QRF1|hFKH1B
Gene Description forkhead box P1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXP1 (AAH05055, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27086
Clone Number 4E3-G11
Iso type IgG2b

Enviar uma mensagem


FOXP1 monoclonal antibody (M01), clone 4E3-G11

FOXP1 monoclonal antibody (M01), clone 4E3-G11