DAPP1 purified MaxPab mouse polyclonal antibody (B01P)
  • DAPP1 purified MaxPab mouse polyclonal antibody (B01P)

DAPP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027071-B01P
DAPP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DAPP1 protein.
Información adicional
Size 50 ug
Gene Name DAPP1
Gene Alias BAM32|DKFZp667E0716
Gene Description dual adaptor of phosphotyrosine and 3-phosphoinositides
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DAPP1 (AAH12924.1, 1 a.a. ~ 280 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27071

Enviar uma mensagem


DAPP1 purified MaxPab mouse polyclonal antibody (B01P)

DAPP1 purified MaxPab mouse polyclonal antibody (B01P)