PPA2 polyclonal antibody (A01)
  • PPA2 polyclonal antibody (A01)

PPA2 polyclonal antibody (A01)

Ref: AB-H00027068-A01
PPA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPA2.
Información adicional
Size 50 uL
Gene Name PPA2
Gene Alias FLJ20459|HSPC124|MGC49850|SID6-306
Gene Description pyrophosphatase (inorganic) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPA2 (NP_789845, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27068

Enviar uma mensagem


PPA2 polyclonal antibody (A01)

PPA2 polyclonal antibody (A01)