STAU2 monoclonal antibody (M14), clone 3B7
  • STAU2 monoclonal antibody (M14), clone 3B7

STAU2 monoclonal antibody (M14), clone 3B7

Ref: AB-H00027067-M14
STAU2 monoclonal antibody (M14), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant STAU2.
Información adicional
Size 100 ug
Gene Name STAU2
Gene Alias 39K2|39K3|DKFZp781K0371|MGC119606
Gene Description staufen, RNA binding protein, homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq LGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAU2 (NP_055208, 341 a.a. ~ 440 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27067
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


STAU2 monoclonal antibody (M14), clone 3B7

STAU2 monoclonal antibody (M14), clone 3B7