PELP1 monoclonal antibody (M03A), clone 2B6
  • PELP1 monoclonal antibody (M03A), clone 2B6

PELP1 monoclonal antibody (M03A), clone 2B6

Ref: AB-H00027043-M03A
PELP1 monoclonal antibody (M03A), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PELP1.
Información adicional
Size 200 uL
Gene Name PELP1
Gene Alias HMX3|MNAR|P160
Gene Description proline, glutamate and leucine rich protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 27043
Clone Number 2B6
Iso type IgM Kappa

Enviar uma mensagem


PELP1 monoclonal antibody (M03A), clone 2B6

PELP1 monoclonal antibody (M03A), clone 2B6