NPHP3 monoclonal antibody (M05), clone 3B1
  • NPHP3 monoclonal antibody (M05), clone 3B1

NPHP3 monoclonal antibody (M05), clone 3B1

Ref: AB-H00027031-M05
NPHP3 monoclonal antibody (M05), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPHP3.
Información adicional
Size 100 ug
Gene Name NPHP3
Gene Alias DKFZp667K242|DKFZp781K1312|FLJ30691|FLJ36696|KIAA2000|MGC78666|NPH3
Gene Description nephronophthisis 3 (adolescent)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPHP3 (NP_694972.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27031
Clone Number 3B1
Iso type IgG1 Kappa

Enviar uma mensagem


NPHP3 monoclonal antibody (M05), clone 3B1

NPHP3 monoclonal antibody (M05), clone 3B1