NGFRAP1 monoclonal antibody (M01), clone 4E5
  • NGFRAP1 monoclonal antibody (M01), clone 4E5

NGFRAP1 monoclonal antibody (M01), clone 4E5

Ref: AB-H00027018-M01
NGFRAP1 monoclonal antibody (M01), clone 4E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NGFRAP1.
Información adicional
Size 100 ug
Gene Name NGFRAP1
Gene Alias BEX3|Bex|DXS6984E|HGR74|NADE
Gene Description nerve growth factor receptor (TNFRSF16) associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NGFRAP1 (AAH03190, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27018
Clone Number 4E5
Iso type IgG2b Kappa

Enviar uma mensagem


NGFRAP1 monoclonal antibody (M01), clone 4E5

NGFRAP1 monoclonal antibody (M01), clone 4E5