TPK1 polyclonal antibody (A01)
  • TPK1 polyclonal antibody (A01)

TPK1 polyclonal antibody (A01)

Ref: AB-H00027010-A01
TPK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TPK1.
Información adicional
Size 50 uL
Gene Name TPK1
Gene Alias HTPK1|PP20
Gene Description thiamin pyrophosphokinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPK1 (NP_071890, 157 a.a. ~ 243 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27010

Enviar uma mensagem


TPK1 polyclonal antibody (A01)

TPK1 polyclonal antibody (A01)