USP21 monoclonal antibody (M03), clone 3D10
  • USP21 monoclonal antibody (M03), clone 3D10

USP21 monoclonal antibody (M03), clone 3D10

Ref: AB-H00027005-M03
USP21 monoclonal antibody (M03), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP21.
Información adicional
Size 100 ug
Gene Name USP21
Gene Alias MGC3394|USP16|USP23
Gene Description ubiquitin specific peptidase 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP21 (NP_036607, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27005
Clone Number 3D10
Iso type IgG2a Kappa

Enviar uma mensagem


USP21 monoclonal antibody (M03), clone 3D10

USP21 monoclonal antibody (M03), clone 3D10