USP21 polyclonal antibody (A01)
  • USP21 polyclonal antibody (A01)

USP21 polyclonal antibody (A01)

Ref: AB-H00027005-A01
USP21 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP21.
Información adicional
Size 50 uL
Gene Name USP21
Gene Alias MGC3394|USP16|USP23
Gene Description ubiquitin specific peptidase 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP21 (NP_036607, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27005

Enviar uma mensagem


USP21 polyclonal antibody (A01)

USP21 polyclonal antibody (A01)