HBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • HBP1 purified MaxPab mouse polyclonal antibody (B01P)

HBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026959-B01P
HBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HBP1 protein.
Información adicional
Size 50 ug
Gene Name HBP1
Gene Alias FLJ16340
Gene Description HMG-box transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMLCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HBP1 (AAH22329.1, 1 a.a. ~ 514 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26959

Enviar uma mensagem


HBP1 purified MaxPab mouse polyclonal antibody (B01P)

HBP1 purified MaxPab mouse polyclonal antibody (B01P)