STEAP1 monoclonal antibody (M01A), clone 4F6-1F3
  • STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

Ref: AB-H00026872-M01A
STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant STEAP1.
Información adicional
Size 200 uL
Gene Name STEAP1
Gene Alias MGC19484|PRSS24|STEAP
Gene Description six transmembrane epithelial antigen of the prostate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 26872
Clone Number 4F6-1F3
Iso type IgG1 Kappa

Enviar uma mensagem


STEAP1 monoclonal antibody (M01A), clone 4F6-1F3

STEAP1 monoclonal antibody (M01A), clone 4F6-1F3