CKAP2 monoclonal antibody (M08), clone 3B9
  • CKAP2 monoclonal antibody (M08), clone 3B9

CKAP2 monoclonal antibody (M08), clone 3B9

Ref: AB-H00026586-M08
CKAP2 monoclonal antibody (M08), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CKAP2.
Información adicional
Size 100 ug
Gene Name CKAP2
Gene Alias DKFZp686L1238|FLJ10749|LB1|TMAP|se20-10
Gene Description cytoskeleton associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CKAP2 (AAH10901.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26586
Clone Number 3B9
Iso type IgG2a Kappa

Enviar uma mensagem


CKAP2 monoclonal antibody (M08), clone 3B9

CKAP2 monoclonal antibody (M08), clone 3B9