BSCL2 monoclonal antibody (M01), clone 1G4
  • BSCL2 monoclonal antibody (M01), clone 1G4

BSCL2 monoclonal antibody (M01), clone 1G4

Ref: AB-H00026580-M01
BSCL2 monoclonal antibody (M01), clone 1G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BSCL2.
Información adicional
Size 100 ug
Gene Name BSCL2
Gene Alias GNG3LG|HMN5|MGC4694|SPG17
Gene Description Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BSCL2 (NP_116056, 259 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26580
Clone Number 1G4
Iso type IgG1 Kappa

Enviar uma mensagem


BSCL2 monoclonal antibody (M01), clone 1G4

BSCL2 monoclonal antibody (M01), clone 1G4