BSCL2 polyclonal antibody (A01)
  • BSCL2 polyclonal antibody (A01)

BSCL2 polyclonal antibody (A01)

Ref: AB-H00026580-A01
BSCL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BSCL2.
Información adicional
Size 50 uL
Gene Name BSCL2
Gene Alias GNG3LG|HMN5|MGC4694|SPG17
Gene Description Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BSCL2 (NP_116056, 259 a.a. ~ 357 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26580

Enviar uma mensagem


BSCL2 polyclonal antibody (A01)

BSCL2 polyclonal antibody (A01)