RGS17 polyclonal antibody (A01)
  • RGS17 polyclonal antibody (A01)

RGS17 polyclonal antibody (A01)

Ref: AB-H00026575-A01
RGS17 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RGS17.
Información adicional
Size 50 uL
Gene Name RGS17
Gene Alias RGS-17|RGSZ2|hRGS17
Gene Description regulator of G-protein signaling 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS17 (NP_036551, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26575

Enviar uma mensagem


RGS17 polyclonal antibody (A01)

RGS17 polyclonal antibody (A01)