AATF polyclonal antibody (A01)
  • AATF polyclonal antibody (A01)

AATF polyclonal antibody (A01)

Ref: AB-H00026574-A01
AATF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AATF.
Información adicional
Size 50 uL
Gene Name AATF
Gene Alias CHE-1|CHE1|DED
Gene Description apoptosis antagonizing transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AATF (AAH00591, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26574

Enviar uma mensagem


AATF polyclonal antibody (A01)

AATF polyclonal antibody (A01)