DAZAP1 monoclonal antibody (M03), clone 2F6
  • DAZAP1 monoclonal antibody (M03), clone 2F6

DAZAP1 monoclonal antibody (M03), clone 2F6

Ref: AB-H00026528-M03
DAZAP1 monoclonal antibody (M03), clone 2F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DAZAP1.
Información adicional
Size 100 ug
Gene Name DAZAP1
Gene Alias MGC19907
Gene Description DAZ associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAZAP1 (NP_061832.2, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26528
Clone Number 2F6
Iso type IgG1 Kappa

Enviar uma mensagem


DAZAP1 monoclonal antibody (M03), clone 2F6

DAZAP1 monoclonal antibody (M03), clone 2F6