TIMM8B polyclonal antibody (A01)
  • TIMM8B polyclonal antibody (A01)

TIMM8B polyclonal antibody (A01)

Ref: AB-H00026521-A01
TIMM8B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TIMM8B.
Información adicional
Size 50 uL
Gene Name TIMM8B
Gene Alias DDP2|FLJ21744|MGC102866|MGC117373|TIM8B
Gene Description translocase of inner mitochondrial membrane 8 homolog B (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM8B (NP_036591, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26521

Enviar uma mensagem


TIMM8B polyclonal antibody (A01)

TIMM8B polyclonal antibody (A01)