TIMM13 polyclonal antibody (A01)
  • TIMM13 polyclonal antibody (A01)

TIMM13 polyclonal antibody (A01)

Ref: AB-H00026517-A01
TIMM13 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TIMM13.
Información adicional
Size 50 uL
Gene Name TIMM13
Gene Alias TIM13|TIM13B|TIMM13A|TIMM13B|ppv1
Gene Description translocase of inner mitochondrial membrane 13 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26517

Enviar uma mensagem


TIMM13 polyclonal antibody (A01)

TIMM13 polyclonal antibody (A01)