FXC1 monoclonal antibody (M04), clone 1A11
  • FXC1 monoclonal antibody (M04), clone 1A11

FXC1 monoclonal antibody (M04), clone 1A11

Ref: AB-H00026515-M04
FXC1 monoclonal antibody (M04), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FXC1.
Información adicional
Size 100 ug
Gene Name FXC1
Gene Alias TIM10B|TIMM10B|Tim9b
Gene Description fracture callus 1 homolog (rat)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FXC1 (NP_036324.1, 11 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26515
Clone Number 1A11
Iso type IgG2a Kappa

Enviar uma mensagem


FXC1 monoclonal antibody (M04), clone 1A11

FXC1 monoclonal antibody (M04), clone 1A11