DDX26 monoclonal antibody (M02), clone 3D9
  • DDX26 monoclonal antibody (M02), clone 3D9

DDX26 monoclonal antibody (M02), clone 3D9

Ref: AB-H00026512-M02
DDX26 monoclonal antibody (M02), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDX26.
Información adicional
Size 100 ug
Gene Name INTS6
Gene Alias DBI-1|DDX26|DDX26A|DICE1|DKFZp434B105|HDB|INT6|Notchl2
Gene Description integrator complex subunit 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX26 (NP_036273, 779 a.a. ~ 887 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26512
Clone Number 3D9
Iso type IgG1 Kappa

Enviar uma mensagem


DDX26 monoclonal antibody (M02), clone 3D9

DDX26 monoclonal antibody (M02), clone 3D9