PPP1R14B monoclonal antibody (M07), clone 4G2
  • PPP1R14B monoclonal antibody (M07), clone 4G2

PPP1R14B monoclonal antibody (M07), clone 4G2

Ref: AB-H00026472-M07
PPP1R14B monoclonal antibody (M07), clone 4G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1R14B.
Información adicional
Size 100 ug
Gene Name PPP1R14B
Gene Alias PHI-1|PLCB3N|PNG|SOM172
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 14B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R14B (NP_619634.1, 64 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26472
Clone Number 4G2
Iso type IgG2a Kappa

Enviar uma mensagem


PPP1R14B monoclonal antibody (M07), clone 4G2

PPP1R14B monoclonal antibody (M07), clone 4G2