PTPN18 purified MaxPab mouse polyclonal antibody (B01P)
  • PTPN18 purified MaxPab mouse polyclonal antibody (B01P)

PTPN18 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026469-B01P
PTPN18 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTPN18 protein.
Información adicional
Size 50 ug
Gene Name PTPN18
Gene Alias BDP1|PTP-HSCF
Gene Description protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPN18 (AAH52800.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26469

Enviar uma mensagem


PTPN18 purified MaxPab mouse polyclonal antibody (B01P)

PTPN18 purified MaxPab mouse polyclonal antibody (B01P)