LHX6 monoclonal antibody (M02), clone 1B11
  • LHX6 monoclonal antibody (M02), clone 1B11

LHX6 monoclonal antibody (M02), clone 1B11

Ref: AB-H00026468-M02
LHX6 monoclonal antibody (M02), clone 1B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX6.
Información adicional
Size 100 ug
Gene Name LHX6
Gene Alias LHX6.1|MGC119542|MGC119544|MGC119545
Gene Description LIM homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26468
Clone Number 1B11
Iso type IgG2a Kappa

Enviar uma mensagem


LHX6 monoclonal antibody (M02), clone 1B11

LHX6 monoclonal antibody (M02), clone 1B11