FGF21 monoclonal antibody (M02), clone 1A8
  • FGF21 monoclonal antibody (M02), clone 1A8

FGF21 monoclonal antibody (M02), clone 1A8

Ref: AB-H00026291-M02
FGF21 monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FGF21.
Información adicional
Size 100 ug
Gene Name FGF21
Gene Alias -
Gene Description fibroblast growth factor 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26291
Clone Number 1A8
Iso type IgG1 Kappa

Enviar uma mensagem


FGF21 monoclonal antibody (M02), clone 1A8

FGF21 monoclonal antibody (M02), clone 1A8